PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016444432.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 189aa    MW: 21977.3 Da    PI: 5.3082
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016444432.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-172165147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+ + eE+el+++++k++G++ W+ Ia++++ gR+++++k+ w+ +
   XP_016444432.1 21 KGNYSLEEEELIIKLHKEHGNR-WSVIAARLP-GRSDNDVKNQWHAH 65
                     7899******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.461115IPR017877Myb-like domain
SuperFamilySSF466892.51E-22272IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-10227IPR009057Homeodomain-like
PROSITE profilePS5129423.5041670IPR017930Myb domain
SMARTSM007172.4E-172068IPR001005SANT/Myb domain
PfamPF002491.3E-152165IPR001005SANT/Myb domain
CDDcd001672.86E-122366No hitNo description
Gene3DG3DSA:1.10.10.603.9E-202869IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MRCGKSCRLR WMNYLRPGLK KGNYSLEEEE LIIKLHKEHG NRWSVIAARL PGRSDNDVKN  60
QWHAHLKKRA KTNTNNNSPI MEQFSESSQS GSQSEQYSHK VSEQEAGCDT ASVNAVDTSV  120
EVSSTDLYSS FSLLNGMDWI EEDHIRSMEQ LPADFFNFCW TNPIDNFQTE PFDNFQTEPL  180
DNFWRQPFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1827240110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16571LKKRAKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766828.11e-142PREDICTED: myb-related protein Myb4-like isoform X2
RefseqXP_016444432.11e-142PREDICTED: myb-related protein Myb4-like isoform X2
TrEMBLM1DB487e-58M1DB48_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000861652e-57(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-28myb domain protein 14